PAFA2_RAT   P83006


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P83006

Recommended name:Platelet-activating factor acetylhydrolase 2, cytoplasmic 1 Publication

EC number:EC:3.1.1.47

Alternative names:PAF:lysophospholipid transacetylase 1 Publication PAF:sphingosine transacetylase 1 Publication Platelet-activating factor acetyltransferase PAFAH2 Curated (EC:2.3.1.149 1 Publication) . EC:2.3.1.149 (UniProtKB | ENZYME | Rhea) 1 Publication Serine-dependent phospholipase A2 By Similarity (SD-PLA2 Curated)

Cleaved into:

GeneID:313611

Gene names  (primary ):Pafah2

Gene names  (synonym ):

Gene names  (ORF ):

Length:390

Mass:43,492

Sequence:MGAGQSICFPPISGPHHIGCTDVMEGHSLEGSLFRLFYPCEASETCEQPLWIPRYEYCVGLADYLQYNKRWVGLLFNVGIGSCRLPVSWNGPFKTKESGYPLIILSHGLGGFRVSYSAFCMELASRGFVVAAIEHRDQSAAATYFCKQTSQESSPTESLEEEWIPFRRIKEGEKEFHVRNPQVHQRAKECVRVLQILQDASAGKPVINVFPGGLDLMTLKGSIDMSRVAVMGHSFGGATAILALTQEAQFRCAIALDAWMFPLEHDFYPKARGPVFFINVEKFQTVESVNLMKKICAQHEQSRIVTVLGAVHRSQTDFAFVTGNMIGKLFSSGTRGTLDPYEGQEVMVRAMLAFLQKHLDLKEDYDQWNSFIEGIGPSLIQGAPHYLSSL

Tissue specificity:Expressed in kidney. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp