AAKB1_MOUSE   Q9R078


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R078

Recommended name:5'-AMP-activated protein kinase subunit beta-1

EC number:

Alternative names:(AMPK subunit beta-1) (AMPKb)

Cleaved into:

GeneID:19079

Gene names  (primary ):Prkab1

Gene names  (synonym ):

Gene names  (ORF ):

Length:270

Mass:30308

Sequence:MGNTSSERAALERQAGHKTPRRDSSGGAKDGDRPKILMDSPEDADIFHSEEIKAPEKEEFLAWQHDLEANDKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSQNNFVAILDLPEGEHQYKFFVDGQWTHDPSEPIVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYMSKPEERFKAPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI

Tissue specificity:

Induction:

Developmental stage:

Protein families:5'-AMP-activated protein kinase beta subunit family


   💬 WhatsApp