UT1_MOUSE Q8VHL0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VHL0
Recommended name：Urea transporter 1
EC number：
Alternative names：(Solute carrier family 14 member 1) (Urea transporter B) (UT-B) (Urea transporter, erythrocyte)
Cleaved into：
GeneID：108052
Gene names (primary )：Slc14a1
Gene names (synonym )：
Gene names (ORF )：
Length：384
Mass：42126
Sequence：MEDSPTMVKVDRGENQILSCRGRRCGFKVLGYVTGDMKEFANWLKDKPVVLQFMDWILRGISQVVFVSNPISGILILVGLLVQNPWWALCGCVGTVVSTLTALLLSQDRSAIAAGLQGYNATLVGILMAVFSNKGDYFWWLIFPVSAMSMTCPVFSSALSSVLSKWDLPVFTLPFNMALSMYLSATGHYNTFFPSKLFTPVSSVPNITWSELSALELLKSLPVGVGQIYGCDNPWTGGIFLCAILLSSPLMCLHAAIGSLLGVIAGLSLAAPFEDIYFGLWGFNSSLACIAIGGMFMALTWQTHLLALACALFTAYFGACMAHLMAVVHLPACTWSFCLATLLFLLLTTKNPNIYRMPLSKVTYSEENRIFYLQNKKRMVESPL
Tissue specificity：Expressed in brain, kidney, heart, liver, lung, skeletal muscle, spleen, testis, ureter and urinary bladder (at protein level). Along the gastrointestinal tract, detected in colon, jejunum and stomach (at protein level). In the kidney, expressed in some microvessels of the inner and outer medulla, but not all (at protein level). Not detected in the cortex (at protein level). Detected in the urothelium all along the urinary tract, including the papilla surface, the ureter, the bladder and the urethra (at protein level). In the brain, expressed at the border of the corpus callosum and striatum in astrocytic cellular processes surrounding blood microvessels (at protein level). Detected in erythrocytes (at protein level). {ECO:0000269|PubMed:11792714, ECO:0000269|PubMed:12133842, ECO:0000269|PubMed:15563580}.
Induction：Down-regulated by water deprivation in urinary bladder and ureter, but not in kidney medulla, colon, testis nor brain. {ECO:0000269|PubMed:15563580}.
Developmental stage：
Protein families：Urea transporter family