PDZ1I_MOUSE   Q9CQH0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQH0

Recommended name:PDZK1-interacting protein 1

EC number:

Alternative names:(17 kDa membrane-associated protein)

Cleaved into:

GeneID:67182

Gene names  (primary ):Pdzk1ip1

Gene names  (synonym ):Map17

Gene names  (ORF ):

Length:114

Mass:12298

Sequence:MLAFSLLVLGLLAEVAPASCQQGLGNLQPWMQGLIAVAVFLVLVAIVFAVNHFWCQEEPEPGSTVMIIGNKADGVLVGMDGRYSSMASGFRSSEHKNAYENVLEEEGRVRSTPM

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp