PITX1_MOUSE P70314
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70314
Recommended name：Pituitary homeobox 1
EC number：
Alternative names：(Hindlimb-expressed homeobox protein backfoot) (Homeobox protein P-OTX) (Homeobox protein PITX1) (Paired-like homeodomain transcription factor 1) (Pituitary OTX-related factor)
Cleaved into：
GeneID：18740
Gene names (primary )：Pitx1
Gene names (synonym )：Bft Potx Ptx1
Gene names (ORF )：
Length：315
Mass：34075
Sequence：MDAFKGGMSLERLPEGLRPPPPPPHDMGPSFHLARAADPREPLENSASESSDADLPDKERGGEAKGPEDGGAGSAGCGGGAEDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNSAMSPGACPYGTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS
Tissue specificity：Expressed in primordial Rathke pouch, oral epithelium, first branchial arch, duodenum, and hindlimb.
Induction：
Developmental stage：Expressed throughout pituitary development. Not found in 8 dpc embryos but seen in embryos at 8.5 dpc in the region of the first branchial arch and ventral portion of the caudal-most region of the embryo. At 9.5 dpc observed in the hindlimb buds, maxillary and mandibular components of the first branchial arch and Rathke pouch and the pattern of expression continues through 10.5 dpc at 11.5 dpc also found in ventral mesenchyme covering the abdominal cavity and in the nasal epithelium. At 17.5 dpc expressed in derivatives of the first branchial arch, including tongue and mandible as well as duodenum, salivary glands, nasal epithelium and condensing cartilage in the hindlimbs. {ECO:0000269|PubMed:9226452}.
Protein families：Paired homeobox family, Bicoid subfamily