PSB5_MOUSE O55234
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O55234
Recommended name：Proteasome subunit beta type-5
EC number：EC 3.4.25.1
Alternative names：(Macropain epsilon chain) (Multicatalytic endopeptidase complex epsilon chain) (Proteasome chain 6) (Proteasome epsilon chain) (Proteasome subunit X)
Cleaved into：
GeneID：19173
Gene names (primary )：Psmb5
Gene names (synonym )：
Gene names (ORF )：
Length：264
Mass：28532
Sequence：MALASVLQRPMPVNQHGFFGLGGGADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGTTTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLARQCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRISGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVREDGWIRVSSDNVADLHDKYSSVSVP
Tissue specificity：Expressed in uterus at the embryo implantation site. {ECO:0000269|PubMed:16434403, ECO:0000269|PubMed:22341445}.
Induction：Up-regulated in embryonic fibroblasts and neuroblastoma cells by antioxidants through the Nrf2-ARE pathway (at protein level). Up-regulated by the antioxidant dithiolethione (D3T) in liver, small intestine and brain (at protein level). Down-regulated under lithium treatment. {ECO:0000269|PubMed:14612418, ECO:0000269|PubMed:16723119, ECO:0000269|PubMed:17521679, ECO:0000269|PubMed:18349697}.
Developmental stage：
Protein families：Peptidase T1B family