RPRM_MOUSE   Q9JJ72


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JJ72

Recommended name:Protein reprimo

EC number:

Alternative names:

Cleaved into:

GeneID:67874

Gene names  (primary ):Rprm

Gene names  (synonym ):

Gene names  (ORF ):

Length:109

Mass:11820

Sequence:MNSVLGNQTDVAGLFLVNSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVVFGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY

Tissue specificity:

Induction:By p53/TP53, following X-ray irradiation. {ECO:0000269|PubMed:10930422}.

Developmental stage:

Protein families:Reprimo family


   💬 WhatsApp