DHB14_RAT   A0A8I6GJ95


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A0A8I6GJ95

Recommended name:L-fucose dehydrogenase

EC number:EC:1.1.1.122

Alternative names:Hydroxysteroid 17-beta dehydrogenase 14

Cleaved into:

GeneID:691018

Gene names  (primary ):Hsd17b14

Gene names  (synonym ):

Gene names  (ORF ):

Length:270

Mass:28,157

Sequence:MAAVGRYSGKVVVVTGGSRGIGAAIVRAFVDSGAQVVFCDKDEAGGRAVEQELLGTVFIPGDVTQEGDLQTLISETVSRFGHLDCVVNNAGYHPPAQLPEETSAQGFRQLLEENLLGAYTLIKLALPHLRKSKGNIINISSLVGAIGQSQALTYVATKGAVTAMTKALALDESRYGVRVNCISPGNIWTPLWQELAAATSDPRATILEGTLAQPLGRMGQPAEVGAAAVFLASEATFCTGLELFMTGGAELGYGRKASSSTLVEVPILPP

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp