NENF_MOUSE Q9CQ45
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CQ45
Recommended name：Neudesin
EC number：
Alternative names：(Neuron-derived neurotrophic factor) (Secreted protein of unknown function) (SPUF protein)
Cleaved into：
GeneID：66208
Gene names (primary )：Nenf
Gene names (synonym )：Spuf
Gene names (ORF )：
Length：171
Mass：18904
Sequence：MARPAPWWRLRLLAALVLALALVPVPSAWAGQTPRPAERGPPVRLFTEEELARYGGEEEDQPIYLAVKGVVFDVTSGKEFYGRGAPYNALAGKDSSRGVAKMSLDPADLTHDTTGLTAKELEALDDVFSKVYKAKYPIVGYTARRILNEDGSPNLDFKPEDQPHFDIKDEF
Tissue specificity：In the embryo, expressed most abundantly in brain and spinal cord. Widely expressed in adult tissues including brain, heart, lung and kidney. In brain, expressed in neurons but not in glial cells (PubMed:15605373). In the hypothalamus is expressed primarily in the paraventricular nucleus (PVN), with lower levels of expression in the arcuate nucleus (ARC)(PubMed:23576617). {ECO:0000269|PubMed:15605373, ECO:0000269|PubMed:23576617}.
Induction：
Developmental stage：In embryonic cerebral cortex is first weakly detected at 12.5 dpc, and thereafter gradually increased. At 13.5 dpc expression is observed mostly in the preplate. {ECO:0000269|PubMed:16547973}.
Protein families：Cytochrome b5 family, MAPR subfamily