AVPI1_MOUSE   Q9D7H4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D7H4

Recommended name:Arginine vasopressin-induced protein 1

EC number:

Alternative names:(AVP-induced protein 1) (Arginine vasopressin-induced transcript 32 protein) (VIP32) (VIT32)

Cleaved into:

GeneID:69534

Gene names  (primary ):Avpi1

Gene names  (synonym ):

Gene names  (ORF ):

Length:142

Mass:15802

Sequence:MGTPASVVSEPPLWQVSTPQTRGRKQASANIFQDAELVQIQGLFQRSGDQLAEERAQIIWECAGDHRVAEALRRLRRKRPPKQNHCSRLRVPEPGSTASDPQASTTDTASSEQSGNSRRTSARAPRNWNKPGPTGYLHQIRH

Tissue specificity:

Induction:By vasopressin. {ECO:0000269|PubMed:12356727, ECO:0000269|PubMed:15140762}.

Developmental stage:

Protein families:


   💬 WhatsApp