RTF2_RAT   Q3T1J8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3T1J8

Recommended name:Replication termination factor 2 Curated

EC number:

Alternative names:Replication termination factor 2 domain-containing protein 1

Cleaved into:

GeneID:296410

Gene names  (primary ):Rtf2

Gene names  (synonym ):Rtfdc1

Gene names  (ORF ):

Length:306

Mass:33,812

Sequence:MGCDGGTIPKRHELVKGPKKVEKVDKDAELVAQWNYCTLSQEVLRRPIVACELGRLYNKDAVIEFLLDKSAEKALGKATSHIRSIKNVTELKLSDNPAWEGDKGNTKGDKHDDLQRARFICPVVGLEMNGRHRFCFLRCCGCVFSERALKEIKAEVCHTCGAAFQEEDIIVLNGTKEDVEMLKRRMEERRLRAKLEKKTKKPKTAESASKLGISQDSAGPSKAKAGKSEEADPDPREKKSSLAPRGTASNGSASGKVGKPPCGALKRSIADSEESETYKSIFTSHSSAKRSKEESAHWVTHTSYCF

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp