GTSF1_MOUSE Q9DAN6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9DAN6
Recommended name：Gametocyte-specific factor 1
EC number：
Alternative names：(Protein FAM112B)
Cleaved into：
GeneID：74174
Gene names (primary )：Gtsf1
Gene names (synonym )：Cue110 Fam112b
Gene names (ORF )：
Length：167
Mass：19083
Sequence：MEDTYIDSLDPEKLLQCPYDKNHQIRACRFPYHLIKCRKNHPDVANKLATCPFNARHQVPRAEISHHISSCDDKSCIEQDVVNQTRNLGQETLAESTWQCPPCDEDWDKDLWEQTSTPFVWGTASFCGNNSPANNIVMEHKSNLASGMRVPKSLPYVLPWKNNGNAQ
Tissue specificity：Expressed abundantly in adult testis, at moderate levels in unfertilized eggs and ovaries and weakly in embryonic stem cells. {ECO:0000269|PubMed:17919994}.
Induction：
Developmental stage：In the male gonad, barely detected at 13.5 dpc or at birth, detected weakly on postnatal day 14 and maximally expressed in the 4- or 7-week-old mouse testis but not detected in the epididymis of the 7-week-old mouse (at protein level). In the female gonad, low levels detected at birth (at protein level). In the adult testis, present predominantly in pachytene spermatocytes and round spermatids but not in spermatogonia, preleptotene spermatocytes or elongating spermatids (at protein level). {ECO:0000269|PubMed:17919994}.
Protein families：UPF0224 (FAM112) family