LRAT_MOUSE   Q9JI60


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JI60

Recommended name:Lecithin retinol acyltransferase

EC number:EC 2.3.1.135

Alternative names:(Phosphatidylcholine--retinol O-acyltransferase) (Phosphatidylcholine-retinol-O-acyltransferase)

Cleaved into:

GeneID:79235

Gene names  (primary ):Lrat

Gene names  (synonym ):

Gene names  (ORF ):

Length:231

Mass:25820

Sequence:MKNPMLEAASLLLEKLLLISNFKLFSVSVPGGGTGKNRPYEISSFVRGDVLEVSRTHFIHYGIYLGENRVAHLMPDILLALTNDKERTQKVVSNKRLLLGVICKVASIRVDTVEDFAYGADILVNHLDGTLKKKSLLNEEVARRAEQQLGLTPYSLLWNNCEHFVTYCRYGSRISPQAEKFYDTVKIIIRDQRSSLASAVLGLASIVYTGLASYMTLPAICIPFCLWMMSG

Tissue specificity:Hepatic stellate cells and endothelial cells (at protein level). {ECO:0000269|PubMed:18544127}.

Induction:LRAT activity is up-regulated by dietary vitamin A (By similarity). Under conditions of vitamin A depletion, LRAT expression in the liver is induced by retinoic acid. {ECO:0000250, ECO:0000269|PubMed:11108736}.

Developmental stage:

Protein families:H-rev107 family


   💬 WhatsApp