SAP18_MOUSE O55128
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O55128
Recommended name:Histone deacetylase complex subunit SAP18
EC number:
Alternative names:(18 kDa Sin3-associated polypeptide) (Sin3-associated polypeptide p18)
Cleaved into:
GeneID:20220
Gene names (primary ):Sap18
Gene names (synonym ):
Gene names (ORF ):
Length:153
Mass:17595
Sequence:MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFMDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPSSGRMRPY
Tissue specificity:Expressed in all tissues tested; highest levels in the brain, kidney and muscle; lowest levels in lung spleen, liver, intestine and testis, and moderate levels in salivary gland and heart. {ECO:0000269|PubMed:9511770}.
Induction:
Developmental stage:
Protein families:SAP18 family