INKA1_MOUSE Q9CX62
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CX62
Recommended name：PAK4-inhibitor INKA1
EC number：
Alternative names：(Induced in neural crest by AP2-alpha protein homolog) (MInca) (Inka box actin regulator 1)
Cleaved into：
GeneID：68176
Gene names (primary )：Inka1
Gene names (synonym )：Fam212a
Gene names (ORF )：
Length：282
Mass：31804
Sequence：MHSARLDSFLSQLRWELLCARDTGSPPMSGPLQPKPRTDQNVQPKRQFRASDVLEEDSVCCVEEEEEEGLVAEDKGLPLGCPREHALDWDSGFSEVSGSTWREEEPSVPQRQAPRERPPHSQRFSVSDIPMRSRAAVTNIPPAHRPRPKSTPDACLEHWQGLEAEDWTAALLNRGRSRQPLVLGDNCFADLVHNWMELPEATSEGSDGDVPRARARPPQFLLGLSEQLRRRLARARRTAMASKRLSCPPRSEPDLPADISRFAALMNCRSRQPIIYNDVSYL
Tissue specificity：Expressed in tissues of the developing head during neurulation. {ECO:0000269|PubMed:20175189}.
Induction：
Developmental stage：Expressed in the cephalic mesenchyme, heart and paraxial mesoderm prior to 8.5 dpc. Expression is then observed in the migratory neural crest cells and their derivatives. As development progresses, expression is also observed in the limb buds and perichondrial tissue. {ECO:0000269|PubMed:20175189}.
Protein families：INKA family