PTF1A_MOUSE Q9QX98
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QX98
Recommended name：Pancreas transcription factor 1 subunit alpha
EC number：
Alternative names：(Pancreas-specific transcription factor 1a) (bHLH transcription factor p48) (p48 DNA-binding subunit of transcription factor PTF1) (PTF1-p48)
Cleaved into：
GeneID：19213
Gene names (primary )：Ptf1a
Gene names (synonym )：Ptf1p48
Gene names (ORF )：
Length：324
Mass：35185
Sequence：MDAVLLEHFPGGLDTFPSPYFDEEDFFTDQSSRDPLEDSDELLGDEQAEVEFLSHQLHEYCYRDGACLLLQPAPSAAPHALAPPPLGDPGEPEDNVSYCCDAGAPLAAFPYSPGSPPSCLAYPCAAVLSPGARLGGLNGAAAAAAARRRRRVRSEAELQQLRQAANVRERRRMQSINDAFEGLRSHIPTLPYEKRLSKVDTLRLAIGYINFLSELVQADLPLRGSGAGGCGGPGGSRHLGEDSPGNQAQKVIICHRGTRSPSPSDPDYGLPPLAGHSLSWTDEKQLKEQNIIRTAKVWTPEDPRKLNSKSFDNIENEPPFEFVS
Tissue specificity：Expressed in precursors of pancreatic islets, acini and ducts. {ECO:0000269|PubMed:9851981}.
Induction：
Developmental stage：Expressed at an early stage of pancreas development, shortly after the onset of endodermal budding that forms the pancreatic anlage. In 9.5 dpc embryo, expression is in the myelencephalon and the neural tube at the cervical level. In the 10.5 dpc embryo expression expands as a thin stripe to the posterior end of the neural tube. The central nervous system anterior to the myelencephalon is devoid of expression at this stage. In 12-12.5 dpc embryo, expression expands anteriorly to the cerebellum region. During retinogenesis, restricted to postmitotic neuronal precursor population in the ventricular zone of the developing retina. Not expressed before 12.5 dpc when is detected in the central region of the retina. By 14.5, expands from the center to the entire retina. Between 16.5 dpc and P1, continues to be expressed strongly in a subset of cells within the outer neuroblastic layer. Expression begins to be down-regulated by P2 and is undetectable in retinas from P6. {ECO:0000269|PubMed:11318877, ECO:0000269|PubMed:12185368, ECO:0000269|PubMed:15543146, ECO:0000269|PubMed:17075007}.
Protein families：