CD3G_RAT Q64159
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64159
Recommended name：T-cell surface glycoprotein CD3 gamma chain
EC number：
Alternative names：CD3g
Cleaved into：
GeneID：300678
Gene names (primary )：Cd3g
Gene names (synonym )：
Gene names (ORF )：
Length：182
Mass：20,545
Sequence：MEQGKGLAGLFLVISLLQGTMAQQKEEKHLVKVDDSQGDGSVLLTCDFNEKTITWLKDGHRISPPNATKSTWNLGNGAKDPRGMYQCRGAKKKSQLLQVYYRLCENCIELNMGTVSGFIFAEIISIFFLAVGVYFIAGQDGVRQSRASDKQTLLQNEQVYQPLKDREYEQYSRLQGNQVRKK
Tissue specificity：
Induction：
Developmental stage：
Protein families：