TXND9_MOUSE   Q9CQ79


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CQ79

Recommended name:Thioredoxin domain-containing protein 9

EC number:

Alternative names:(ATP-binding protein associated with cell differentiation)

Cleaved into:

GeneID:98258

Gene names  (primary ):Txndc9

Gene names  (synonym ):Apacd

Gene names  (ORF ):

Length:226

Mass:26260

Sequence:MEGNGSVDMFSEVLENQFLQAAKLVENHLDSEIQKLDQIGEDELELLKEKRLAALRKAQQQKQEWLSKGHGEYREIGSERDFFQEVKESEKVVCHFYRDTTFRCKILDRHLAILAKKHLETKFLKLNVEKAPFLCERLRIKVIPTLALLRDGKTQDYVVGFTDLGNTDDFTTETLEWRLGCSDVINYSGNLMEPPFQSQKKFGTNFTKLEKKTIRGKKYDSDSDDD

Tissue specificity:Expressed in testis, liver, heart, kidney, brain, spleen and lung. {ECO:0000269|PubMed:15009089}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp