SCRG1_MOUSE   O88745


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O88745

Recommended name:Scrapie-responsive protein 1

EC number:

Alternative names:(Scrapie-responsive gene 1 protein) (ScRG-1)

Cleaved into:

GeneID:20284

Gene names  (primary ):Scrg1

Gene names  (synonym ):

Gene names  (ORF ):

Length:98

Mass:11173

Sequence:MMKSVVLVILGLTLLLETQAMPSSRLSCYRKLLKDRNCHNLPEGRADLKLIDANVQHHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNH

Tissue specificity:

Induction:

Developmental stage:Expressed at higher levels in the brains of scrapie-infected animals.

Protein families:SCRG1 family


   💬 WhatsApp