SNG2_RAT O54980
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O54980
Recommended name：Synaptogyrin-2 Curated
EC number：
Alternative names：
Cleaved into：
GeneID：89815
Gene names (primary )：Syngr2
Gene names (synonym )：
Gene names (ORF )：
Length：224
Mass：24,711
Sequence：MESGAYGAANAGGSFDLRRYVSQPQVVTRLVSMVLALIVFSCIFGEGYINLHSSDQLHCVFNRNEDACRYGSAIGVLAFLASAFFLVVDAFFSQISNATDRKYLVIGDLLFSALWTFLWFVGFCFLTNQWAATKPDDVLVGADSARAAITFSFFSIFSWGVLASLAYQRYKAGVDAFIQNYVDPTPDPTTAYASYPSASVENYQQPPFTQNVETTEGYQPPPVY
Tissue specificity：Ubiquitously expressed with lower expression in brain (at protein level). 1
Induction：
Developmental stage：
Protein families：