MUSC_MOUSE O88940
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88940
Recommended name：Musculin
EC number：
Alternative names：(Myogenic repressor)
Cleaved into：
GeneID：17681
Gene names (primary )：Msc
Gene names (synonym )：Myor
Gene names (ORF )：
Length：201
Mass：21538
Sequence：MSTGSVSDPEDSEMRGLQRVYPAPASKRPPLLRMERGYGSPSDISSAEEEDGEEEPGSLGAAGGCKRKRLRGADAGGAGGRAGGAGKKPLPPKGSAAECKQSQRNAANARERARMRVLSKAFSRLKTSLPWVPPDTKLSKLDTLRLASSYIAHLRQLLQEDRYEDSYVHPVNLTWPFVVSGRPDSDSKDVSAANRLCGTSA
Tissue specificity：
Induction：
Developmental stage：Expression in embryos is largely restricted to embryonic skeletal muscle lineage. First detected at 9.5 dpc in cells within the first and second branchial arches. At 10.5 dpc, expression was also observed in the myotomal compartment of rostral somites and by 11.5 dpc in myotomes along the whole anterio-posterior axis, as well as in cells within the developing forelimbs and hindlimbs. At 12.5-14.5 dpc, expression was confined to the skeletal muscle lineage (head, neck, trunk, limbs and diaphragm but not cardiac and smooth muscle). At 15 dpc, a peak expression was seen in neonatal limbs. {ECO:0000269|PubMed:9767165}.
Protein families：