EFNB1_RAT   P52796


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P52796

Recommended name:Ephrin-B1

EC number:

Alternative names:Ephrin-B1 C-terminal fragment By Similarity (Ephrin-B1 CTF By Similarity) Ephrin-B1 intracellular domain By Similarity (Ephrin-B1 ICD By Similarity)

Cleaved into:

GeneID:

Gene names  (primary ):Efnb1

Gene names  (synonym ):Eplg2, Lerk2

Gene names  (ORF ):

Length:345

Mass:37,951

Sequence:MARPGQRWLSKWLVAMVVLTLCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNKPQQEIRFTIKFQEFSPNYMGLEFKKYHDYYITSTSNGSLEGLENREGGVCRTRTMKIVMKVGQDPNAVTPEQLTTSRPSKESDNTVKTATQAPGRGSQGDSDGKHETVNQQEKSGPGAGGSGSGDTDSFFNSKVALFAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGDSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV

Tissue specificity:Detected in lung, kidney, heart and testis. 1

Induction:

Developmental stage:Detected at embryonic stage 18 dpc in kidney, heart, brain, lung, skeletal muscle and thymus. Expression is particularly strong in kidney. 1

Protein families:


   💬 WhatsApp