CEL_RAT   P07882


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P07882

Recommended name:Bile salt-activated lipase

EC number:EC:3.1.1.13

Alternative names:BAL

Cleaved into:

GeneID:

Gene names  (primary ):Cel

Gene names  (synonym ):

Gene names  (ORF ):

Length:612

Mass:67,040

Sequence:MGRLEVLFLGLTCCLAAACAAKLGAVYTEGGFVEGVNKKLSLLGGDSVDIFKGIPFATAKTLENPQRHPGWQGTLKATDFKKRCLQATITQDDTYGQEDCLYLNIWVPQGRKQVSHDLPVMVWIYGGAFLMGSGQGANFLKNYLYDGEEIATRGNVIVVTFNYRVGPLGFLSTGDANLPGNFGLRDQHMAIAWVKRNIAAFGGDPDNITIFGESAGAASVSLQTLSPYNKGLIRRAISQSGVALSPWAIQENPLFWAKTIAKKVGCPTEDTAKMAGCLKITDPRALTLAYRLPLKSQEYPIVHYLAFIPVVDGDFIPDDPINLYDNAADIDYLAGINDMDGHLFATVDVPAIDKAKQDVTEEDFYRLVSGHTVAKGLKGTQATFDIYTESWAQDPSQENMKKTVVAFETDILFLIPTEMALAQHRAHAKSAKTYSYLFSHPSRMPIYPKWMGADHADDLQYVFGKPFATPLGYRAQDRTVSKAMIAYWTNFAKSGDPNMGNSPVPTHWYPYTTENGNYLDINKKITSTSMKEHLREKFLKFWAVTFEMLPTVVGDHTPPEDDSEAAPVPPTDDSQGGPVPPTDDSQTTPVPPTDNSQAGDSVEAQMPGPIGF

Tissue specificity:Synthesized primarily in the pancreas and then transported to the intestine.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp