RBMX_MOUSE Q9WV02
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9WV02
Recommended name：RNA-binding motif protein, X chromosome
EC number：
Alternative names：(Heterogeneous nuclear ribonucleoprotein G) (hnRNP G)
Cleaved into：RNA-binding motif protein, X chromosome, N-terminally processed
GeneID：19655
Gene names (primary )：Rbmx
Gene names (synonym )：Hnrnpg Hnrpg Rbmxp1 Rbmxrt
Gene names (ORF )：
Length：391
Mass：42301
Sequence：MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGLPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFTMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGLGGRAPVSRGRDGYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSREYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
Tissue specificity：Both isoforms are widely expressed. {ECO:0000269|PubMed:10391207}.
Induction：By high-fructose diet. {ECO:0000269|PubMed:17188681}.
Developmental stage：
Protein families：