RBMX_MOUSE   Q9WV02


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WV02

Recommended name:RNA-binding motif protein, X chromosome

EC number:

Alternative names:(Heterogeneous nuclear ribonucleoprotein G) (hnRNP G)

Cleaved into:RNA-binding motif protein, X chromosome, N-terminally processed

GeneID:19655

Gene names  (primary ):Rbmx

Gene names  (synonym ):Hnrnpg Hnrpg Rbmxp1 Rbmxrt

Gene names  (ORF ):

Length:391

Mass:42301

Sequence:MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGLPPPPRSRGPPRGLRGGRGGSGGTRGPPSRGGHMDDGGYSMNFTMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGLGGRAPVSRGRDGYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSREYPSSRDTRDYAPPPRDYTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Tissue specificity:Both isoforms are widely expressed. {ECO:0000269|PubMed:10391207}.

Induction:By high-fructose diet. {ECO:0000269|PubMed:17188681}.

Developmental stage:

Protein families:


   💬 WhatsApp