LCN5_MOUSE   A2AJB7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A2AJB7

Recommended name:Epididymal-specific lipocalin-5

EC number:

Alternative names:(Epididymal retinoic acid-binding protein) (E-RABP) (mE-RABP) (Epididymal secretory protein 10) (MEP 10)

Cleaved into:Epididymal-specific lipocalin-5, major form; Epididymal-specific lipocalin-5, minor form

GeneID:13863

Gene names  (primary ):Lcn5

Gene names  (synonym ):Mep10

Gene names  (ORF ):

Length:192

Mass:21013

Sequence:MCSVARHMESIMLFTLLGLCVGLAAGTEAAVVKDFDVNKFLGFWYEIALASKMGAYGLAHKEEKMGAMVVELKENLLALTTTYYNEGHCVLEKVAATQVDGSAKYKVTRISGEKEVVVVATDYMTYTVIDITSLVAGAVHRAMKLYSRSLDNNGEALNNFQKIALKHGFSETDIHILKHDLTCVNALQSGQI

Tissue specificity:Epididymal fluid of the caudal and corpus regions (at protein level). {ECO:0000269|PubMed:14595821}.

Induction:Down-regulated to 11% of control levels 5 days after castration and is not detectable by 20 days (at protein level). Levels are partially restored by subsequent testosterone treatment. {ECO:0000269|PubMed:9607808}.

Developmental stage:

Protein families:Calycin superfamily, Lipocalin family


   💬 WhatsApp