HXA4_MOUSE P06798
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P06798
Recommended name：Homeobox protein Hox-A4
EC number：
Alternative names：(Homeobox protein Hox-1.4) (Homeobox protein MH-3)
Cleaved into：
GeneID：15401
Gene names (primary )：Hoxa4
Gene names (synonym )：Hox-1.4 Hoxa-4
Gene names (ORF )：
Length：285
Mass：30468
Sequence：MTMSSFLINSNYIEPKFPPFEEFAPHGGPGGGDGAVGGGPGYPRPQSAPHLPAPNPHAARQPPAYYAPRAREPSYPGGLYPAPAAACPYACRGASPGRPEQSPAPGAHPSPAPQPPVPLGHCAPGPTTPAVATGGSAPACPLLLADQGPAGPKGKEPVVYPWMKKIHVSAVNSSYNGGEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKDHKLPNTKMRSSNTASAPAGPPGKAQTHSPHHHPHPLPGASTPIPSSI
Tissue specificity：
Induction：
Developmental stage：During development of the prepuberal testis high levels of HOXA4 transcripts were found at days 17, 24 and 30. The first day of HOXA4 expression was day 14. The activation of the HOXA4 gene in male germ cells seems to occur at the pachytene stage of meiotic prophase and its level of expression is stage-specific during embryogenesis.
Protein families：Antp homeobox family, Deformed subfamily