SIA7C_MOUSE   Q9WUV2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WUV2

Recommended name:Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3

EC number:EC 2.4.99.7

Alternative names:(GalNAc alpha-2,6-sialyltransferase III) (ST6GalNAc III) (ST6GalNAcIII) (STY) (Sialyltransferase 7C) (SIAT7-C)

Cleaved into:

GeneID:20447

Gene names  (primary ):St6galnac3

Gene names  (synonym ):Siat7c

Gene names  (ORF ):

Length:305

Mass:35414

Sequence:MACILKRKPVLVVSFIALCILLLAMRLVNDATFPLLLNCFGQPKTKWIPLPYTFRQPLRTHYGYINVRTQEPLQLNCNHCAIVSNSGQMVGQKVGEEIDHASCIWRMNNAPTKGFEEDVGYMTMVRVVSHTSVPLLLKNPDYFFKEASRTIYVIWGPFRNMRKDGNGIVYNMLKKTVDAYPDAQIYVTTEQQMTHCDRVFKDETGKDRVQSGSYLSTGWFTFILAMDACYSIHVYGMINETYCKTEGYRKVPYHYYEQGKDECNEYLLHEHAPYGGHRFITEKKVFAKWAKKHRIVFTHPNWTLS

Tissue specificity:In adult tissues, high expression in brain, lung and heart and to a lesser extent in kidney, mammary gland, spleen, testis and thymus. {ECO:0000269|PubMed:10207017}.

Induction:

Developmental stage:In brain, expression reaches maximum levels at day 12 of the embryonic stage. Keeps almost similar levels during mouse development. {ECO:0000269|PubMed:10207017}.

Protein families:Glycosyltransferase 29 family


   💬 WhatsApp