DFAL1_RAT Q4JEI2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q4JEI2
Recommended name：Defensin alpha-like protein 1 Imported
EC number：
Alternative names：
Cleaved into：
GeneID：613220
Gene names (primary )：Defal1
Gene names (synonym )：Defa-rs1 1 Publication
Gene names (ORF )：
Length：87
Mass：9,702
Sequence：MKTLILLSALVLLALQVQADPIQEAEEETKTEEQPADEDQDVSVSFEGPEASAVQDLRVRRTLQCSCRRVCRNTCSCIRLSRSTYAS
Tissue specificity：Specifically expressed in small intestine (jejunum and ileum) (PubMed:15494476, PubMed:23380721). Probably expressed by Paneth cells at the base of intestinal crypts (PubMed:23380721). Coexpressed with MMP7 in small intestine (PubMed:23380721). 2 s
Induction：
Developmental stage：
Protein families：