WFD18_RAT   P14730


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P14730

Recommended name:WAP four-disulfide core domain protein 18

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Wfdc18

Gene names  (synonym ):Expi, Wdnm1

Gene names  (ORF ):

Length:74

Mass:7,740

Sequence:TASVLLLVALIAVGMNITYALFSPTKLEKPGKCPKNPPRSIGTCVELCSGDQSCPNIQKCCSNGCGHVCKSPVF

Tissue specificity:Spleen, kidney, brain, liver, lung and cell line Rat-2.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp