ZFN2A_MOUSE   Q9JII7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JII7

Recommended name:AN1-type zinc finger protein 2A

EC number:

Alternative names:(Arsenite-inducible RNA-associated protein)

Cleaved into:

GeneID:100494

Gene names  (primary ):Zfand2a

Gene names  (synonym ):Airap

Gene names  (ORF ):

Length:171

Mass:19281

Sequence:MEFPDLGKHCSEPTCKQLDFLPITCDACKQDFCKDHFSYVGHKCPFAFKKDVQVPVCPLCNAPIPVKRGEIPDVVVGEHMDRDCTFHPGRNRNKVFTHRCSKEGCRKKEMLQLACAQCHGNFCIQHRHPLDHNCQAGSSSASRGRTSTSRAAEQKPSGVSWLAQRLRRTVK

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp