ACVR1_RAT P80201
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P80201
Recommended name：Activin receptor type-1
EC number：EC:2.7.11.30
Alternative names：Activin receptor type I (ACTR-I) Serine/threonine-protein kinase receptor R1 (SKR1) TGF-B superfamily receptor type I (TSR-I)
Cleaved into：
GeneID：79558
Gene names (primary )：Acvr1
Gene names (synonym )：Acvrlk2
Gene names (ORF )：
Length：509
Mass：57,195
Sequence：MVDGAMILSVLMMMALPSPSMEDEEPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSVNDGFRVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNVTARLPTKGKSFPGSQNFHLEVGLIILSVVFAVCLFACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLAELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC
Tissue specificity：Urogenital ridge, testis, ovary, brain and lungs.
Induction：
Developmental stage：
Protein families：