OSTN_RAT   P61365


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P61365

Recommended name:Osteocrin 1 Publication

EC number:

Alternative names:Processed Osteocrin By Similarity

Cleaved into:

GeneID:360730

Gene names  (primary ):Ostn

Gene names  (synonym ):

Gene names  (ORF ):

Length:132

Mass:14,636

Sequence:MLDWRLASAHFLLAMILMLWGSGKAFSVDLASEASEFGAESLQSPPTTREEKSATELAAKLLLLDDLVSLENDVFETKKKRSFSGFGSPLDRLSAGSVEHRGKQRRVVDHSKKRFGIPMDRIGRNRLSSSRG

Tissue specificity:Highly expressed in skeletal muscle (PubMed:15044443). Also expressed in leg tendons/ligaments and osteoblasts (PubMed:17951249). In long bones and teeth, present in knee joint and periodontal ligaments (at protein level) (PubMed:17951249). 2 s

Induction:Expression was highest in embryos and neonates, peaking at 4 days of age in both calvaria and long bones and decreasing steadily with age to very low levels in 8-month-old long bones. The age-related decrease was less marked in calvaria by 8 months. 1 Publication

Developmental stage:Is down-regulated by 1,25-dihydroxy vitamin D3. 1

Protein families:


   💬 WhatsApp