GBRL1_RAT   Q0VGK0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q0VGK0

Recommended name:Gamma-aminobutyric acid receptor-associated protein-like 1 Curated

EC number:

Alternative names:

Cleaved into:

GeneID:689161

Gene names  (primary ):Gabarapl1

Gene names  (synonym ):Gec1

Gene names  (ORF ):

Length:117

Mass:14,044

Sequence:MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYLVPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHEEDYFLYVAYSDESVYGK

Tissue specificity:High expression in liver and brain, lower in lung and heart and very low in kidney and skeletal muscle (at protein level). Present in all brain regions and spinal cord (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp