TNR18_MOUSE O35714
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O35714
Recommended name：Tumor necrosis factor receptor superfamily member 18
EC number：
Alternative names：(Glucocorticoid-induced TNFR-related protein) (CD antigen CD357)
Cleaved into：
GeneID：21936
Gene names (primary )：Tnfrsf18
Gene names (synonym )：Gitr
Gene names (ORF )：
Length：228
Mass：25334
Sequence：MGAWAMLYGVSMLCVLDLGQPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGHLTVIFLVMAACIFFLTTVQLGLHIWQLRRQHMCPRETQPFAEVQLSAEDACSFQFPEEERGEQTEEKCHLGGRWP
Tissue specificity：Preferentially expressed in activated T lymphocytes.
Induction：Up-regulated in peripherical mononuclear cells after antigen stimulation/lymphocyte activation.
Developmental stage：
Protein families：