CHSTB_MOUSE Q9JME2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JME2
Recommended name：Carbohydrate sulfotransferase 11
EC number：EC 2.8.2.5
Alternative names：(Chondroitin 4-O-sulfotransferase 1) (Chondroitin 4-sulfotransferase 1) (C4S-1) (C4ST-1) (C4ST1)
Cleaved into：
GeneID：58250
Gene names (primary )：Chst11
Gene names (synonym )：
Gene names (ORF )：
Length：352
Mass：41632
Sequence：MKPALLEVMRMNRICRMVLATCFGSFILVIFYFQSMLHPVMRRNPFGVDICCRKGSRSPLQELYNPIQLELSNTAILHQMRRDQVTDTCRANSAMSRKRRVLTPNDLKHLVVDEDHELIYCYVPKVACTNWKRLMMVLSGRGKYSDPMEIPANEAHVSANLKTLNQYSIPEINHRLKSYMKFLFVREPFERLVSAYRNKFTQKYNTSFHKRYGTKIIRRQRKNATQEALRKGDDVKFEEFVAYLIDPHTQREEPFNEHWQTVYSLCHPCHIHYDLVGKYETLEEDSNYVLQLAGVSGYLKFPTYAKSTRTTDEMTTEFFQNISAEHQTQLYEVYKLDFLMFNYSVPNYLKLD
Tissue specificity：Predominantly expressed in brain and kidney. Also expressed at weaker level in heart, spleen and lung. Expressed in developing chondrocytes. {ECO:0000269|PubMed:10722746}.
Induction：By BMP2, suggesting it is a target of BMP signaling. {ECO:0000269|PubMed:12351172}.
Developmental stage：First expressed at day 9.75 of embryogenesis in the apical ectodermal ridge (AER) of the developing limb buds and at the edges of branchial arches 1 and 2. Also expressed in the ventral neural tube, notochord and sympathetic ganglia and the mesonephric tubules of the developing kidneys. In the heart, it is expressed in the myocardium of the atrium and in the endocardial cushions of both the developing inflow tract and the atrioventricular valves. At day 15, it is expressed in the cartilage of developing bones, in vertebrae and cartilage of the trachea as well as in the thymus. In the forelimb, it is expressed in all developing bones, but absent from developing joint regions and was down-regulated in chondrocytes beginning to undergo mineralization, such as in the center of the ulna. At day 15, no expression in the neural tube is observed. In the heart at day 15, it is still expressed in the atrial valve, the atrioventricular valves and in the myocardium of the atrium, while in the kidney, it is expressed in the collecting tubules as well as in Bowman capsule. Interestingly, the liver displays a punctate expression at day 15. Also expressed in tooth primordia, hair follicles and mammary glands. {ECO:0000269|PubMed:12351172}.
Protein families：Sulfotransferase 2 family