ODAM_RAT Q3HS83
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3HS83
Recommended name:Odontogenic ameloblast-associated protein
EC number:
Alternative names:
Cleaved into:
GeneID:641555
Gene names (primary ):Odam
Gene names (synonym ):Apin
Gene names (ORF ):EO-009
Length:278
Mass:30,443
Sequence:MKIIILLGLIGATSSAPLITQRLLSASNSHELLLNLNNGQLLPLQFQSAFNSWIPPFPGLLQQQQQQAQVSGHPQFPLSTLESFAGLFPNQIPFSRQVGFAQGGQAGQPDFSQQQTPSQTQQASPMSYVVPVKVPQDQTQMFQYYPVYMLLPWEQPQQTVTSSPQQTGQQLYEEQIPFYNQFGFVPQQAEPGVPGGQQHLVLDSFVGTAPETPGMPAVEGPLYPQKEPIGFKQDNVGVSTPSTSPKPDTGNFFTSEINPTIAPLLPEQKVNADSLREP
Tissue specificity:Highly expressed in tooth-associated epithelia. In tooth, it is only detected in the ameloblast layer of the enamel organ, starting at post-secretory transition and extending throughout the maturation stage. Also detected in epithelial cells of the gingiva which bind it to the tooth surface (junctional epithelium) (at protein level). Predominantly expressed in mandible, but also expressed at weak level in nasal and salivary glands, and at much lower level in epididymis. 3 s
Induction:
Developmental stage:Specifically expressed in ameloblasts during maturation stages. Not expressed in pre-ameloblasts, weakly expressed in secretory ameloblasts, and strongly expressed in maturation-stage ameloblasts as well as in the junctional epithelium attached to the enamel of erupted molars. 2 s
Protein families: