MMP23_RAT O88272
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88272
Recommended name:Matrix metalloproteinase-23
EC number:EC:3.4.24.-
Alternative names:MMP-23
Cleaved into:
GeneID:94339
Gene names (primary ):Mmp23
Gene names (synonym ):Mifr
Gene names (ORF ):
Length:391
Mass:44,618
Sequence:MGWRACLRPEASGAVQGRWLGAVLSGLCLLSALAFLEWLGSPTETAWNAAQGNVDAPDVGGSTPQVPSLLSMLVTRRRRYTLTPARLRWDHFNLTYRILSFPRNLLSPEETRRGLAAAFRMWSDVSPFSFREVAPERPSDLKIGFYPVNHTDCLVSALHHCFDGPTGELAHAFFPPHGGIHFDDSEYWVLGPTRYSWKKGVWLTDLVHVAAHEIGHALGLMHSQQDQALMHLNATLRGWKALSQDELWGLHRLYGCLDRIFVCTSWARKGFCDVRQRLMKRLCPRSCDFCYEFPFPTVATTTSPTRTKTRFVREGRNMTFHCGQKILHKKGKVYWYKDQEPLEFSYPGYLALGEARLSIIANAVNEGTYTCVVRHRQRVLTTYSWRVRVRS
Tissue specificity:Expressed at the highest levels in ovary and uterus. In ovary expression is strictly confined to granulosa cells of preantral and small antral follicles. Detected also in testis and prostate. 1
Induction:
Developmental stage:
Protein families:peptidase M10A family