S2539_RAT   Q4V8K4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4V8K4

Recommended name:Mitochondrial glutathione transporter SLC25A39 Curated

EC number:

Alternative names:

Cleaved into:

GeneID:360636

Gene names  (primary ):Slc25a39

Gene names  (synonym ):

Gene names  (ORF ):

Length:359

Mass:39,235

Sequence:MDDQDPGGISPLQQMVASGAGAVVTSLFMTPLDVVKVRLQSQRPTVASELTTPSRFWSLSYTKSPSTLQSPGKCLLYCNGVLEPLYLCPNGTRCATWFQDPTRFTGTLDAFVKIVRHEGTRTLWSGLPATLVMTVPATAIYFTAYDQLKAFLCGQSLTSDLYAPMVAGALARMGTVTVVSPLELVRTKLQAQHVSYRELAACVQAAVAQGGWRSLWLGWGPTALRDVPFSALYWFNYELVKSQLNGPRQKEQTSVGISFVAGGISGMVAATLTLPFDVVKTQRQMSLGAVEAMRVKPPRVDSTWLLLRRIQAESGTRGLFAGFLPRIIKAAPSCAIMISTYEFGKSFFHRLNQEQPLGH

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp