TMUB1_MOUSE Q9JMG3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JMG3
Recommended name：Transmembrane and ubiquitin-like domain-containing protein 1
EC number：
Alternative names：(Hepatocyte odd protein shuttling protein)
Cleaved into：iHOPS
GeneID：64295
Gene names (primary )：Tmub1
Gene names (synonym )：Hops
Gene names (ORF )：
Length：245
Mass：26316
Sequence：MALIEGVGDEVTVLFAVLACLLVLALAWVSTHTTESTDPQPQPPGTTTPAQPSEAMSASDSIREEAPGAESPSLRHRGPSAQPEPDTGVTASTPPDSPQEPLLLRLKFLNDSEQVARAWPQDTIGSLKRTQFPGQEQQVRLIYQGQLLGDDTQTLGSLHLPPNCVLHCHVSTRVGPPHPPCPPGSEPGPSGLEIGSLLLPLLLLLLLLLWYCQIQYRPFFPLTATLGLAGFTLLLSLLAFAMYRP
Tissue specificity：Expressed in adult brain; at protein level (PubMed:18665261, PubMed:20582322). Isoform 1 (lHOPS) is highly expressed in small intestine, stomach and epididymis. Isoform 2 (sHOPS) and iHOPS are abundantly expressed in brain, liver and adrenal gland (PubMed:24240191). {ECO:0000269|PubMed:20582322, ECO:0000269|PubMed:24240191}.
Induction：Up-regulated in regenerating liver. {ECO:0000269|PubMed:16014383}.
Developmental stage：
Protein families：