BATF3_MOUSE   Q9D275


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9D275

Recommended name:Basic leucine zipper transcriptional factor ATF-like 3

EC number:

Alternative names:(B-ATF-3)

Cleaved into:

GeneID:381319

Gene names  (primary ):Batf3

Gene names  (synonym ):

Gene names  (ORF ):

Length:118

Mass:13657

Sequence:MSQGPPAVSVLQRSVDAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEHESLEQENSVLRREISKLKEELRHLSEVLKEHEKMCPLLLCPMNFVQLRSDPVASCLPR

Tissue specificity:Highly expressed in CD8-alpha(+) classical dendritic cells (cDCs), with low to absent expression in other immune cells and non-immune tissues. {ECO:0000269|PubMed:19008445}.

Induction:

Developmental stage:

Protein families:BZIP family


   💬 WhatsApp