SC5AC_MOUSE Q49B93
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q49B93
Recommended name:Sodium-coupled monocarboxylate transporter 2
EC number:
Alternative names:(Electroneutral sodium monocarboxylate cotransporter) (Low-affinity sodium-lactate cotransporter) (Solute carrier family 5 member 12)
Cleaved into:
GeneID:241612
Gene names (primary ):Slc5a12
Gene names (synonym ):Smct2
Gene names (ORF ):
Length:619
Mass:67951
Sequence:MRVKNFEAWDYVVFAGLFVISSGIGVFFAIKERKKTTSREFLVGGRQMSFGPVALSLTASFMSAVTVLGTPAEVYRFGASFFLFLISYVFVVFFTSELFLPVFYRSGITSTYEYLQLRFNKPVRYAATIIYIVQTILYTGVVVYAPALALNQVTGFNLWASVFATGIVCTFYCSLGGLKAVVWTDAFQMVVMIVGFLTVLIQGSNHVGGFNNVLEKAGNGSRLHIVDFDVDPLRRHTFWTITIGGTFTWLGVYGVNQSTIQRCISCKTEKHAKLALYFNLLGLWIIVACAVFSGLIMYSHFKDCDPWTSGVISAPDQLMPYFVMEIFATMPGLPGLFVACAFSGTLSTVAASINALATVTFEDFVKSCFPHLSDKLSTWISKGLCILFGIMCTSMAVVASLMGSVVQAALSIHGMCGGPMLGLFTLGLVFPFVNWKGALGGLLTGITLSFWVAIGSFIYPAPESKTLPLPLSTEHCVELNITTTVAPQISSRPVLADTWYSLSYLYFSAVGCLGCIAAGIIISFLTGKQRGKDIDPLLIRPVCNLFCFWSKKYKTLCWCGVQHDRETEQDYLDSGSAWKQGVESGLQNGLKQDTLAQIPGYNPKEKSYSNSVPEKTTYF
Tissue specificity:Expressed in the cortical region of the kidney corresponding to the proximal tubule. Expressed in Mueller cells of the inner retina (at protein level). Isoform 1 is expressed in the retina, kidney, small intestine and skeletal muscle. Isoform 2 is not detected in the kidney, small intestine and skeletal muscle. In the kidney, expressed predominantly in tubular epithelial cells of the cortical region and in the convoluted portions of the proximal tubule (pars convoluta). In the small intestine, its expression is highest in the proximal part and gradually decreased towards the distal end. Expressed in the neural retina. Not detected in the caecum and colon. {ECO:0000269|PubMed:16104846, ECO:0000269|PubMed:16873376, ECO:0000269|PubMed:17591909, ECO:0000269|PubMed:17692818}.
Induction:Up-regulated by CEBPD. {ECO:0000269|PubMed:16873376}.
Developmental stage:
Protein families:Sodium:solute symporter (SSF) (TC 2.A.21) family