AR6P1_MOUSE   Q9JKW0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JKW0

Recommended name:ADP-ribosylation factor-like protein 6-interacting protein 1

EC number:

Alternative names:(ARL-6-interacting protein 1) (Aip-1) (Protein TBX2)

Cleaved into:

GeneID:54208

Gene names  (primary ):Arl6ip1

Gene names  (synonym ):Arl6ip

Gene names  (ORF ):

Length:203

Mass:23437

Sequence:MAEGDNRSSNLLAVETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLLFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFSLKEEKPKMYFMTMIISLAAVAWVGQQVHNLLLTYLIVTFVLLLPGLNQHGIILKYIGMAKREINKLLKQKEKKNE

Tissue specificity:Expressed in the cerebral cortex, cerebellum, hippocampus, olfactory bulbs, medulla oblongate and limbic system (at protein level). Ubiquitous (PubMed:18684713). Expressed in all hematopoietic cell lineages, with highest levels in early myeloid progenitor cells. {ECO:0000269|PubMed:10995579, ECO:0000269|PubMed:18684713}.

Induction:

Developmental stage:

Protein families:ARL6ip family


   💬 WhatsApp