ESIP1_MOUSE Q8VDI1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8VDI1
Recommended name：Epithelial-stromal interaction protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：108670
Gene names (primary )：Epsti1
Gene names (synonym )：
Gene names (ORF )：
Length：314
Mass：36098
Sequence：MYTRSKVVGPGLGTSSISRDHAGAGQRRELGLQQNRRQSLEVAAPEGPKMERQGHADQGSAGTYTLIAPNESRRQKIQRIAEQELADLERWKQQNRAKPVYLVPQRLGGSQSEAEVRQKQQLQQMRSKYQQKLKRDESIRIRKEAEEAKFQKMKAIQREKSNKLEEKKQLQEDIRRATFREHHQSKTAELLSRLDTERRNRSACLIAPPATQSSRWKLPVLLRDPSWAGSQAHRDSPQKEDNPRLQKTRDGHQKNKLLETKGQHQEEERAQIHQAEHWRVNNAFLDRLQGKSQPGGLEQSGGCCNMNSTDSWGL
Tissue specificity：Expressed in the spleen, with expression in T cells, B cells, natural killer cells and natural killer T cells and high expression in monocytes and macrophages. {ECO:0000269|PubMed:29217193}.
Induction：Up-regulated in macrophages upon induction by lipopolysaccharides (LPS) and IFNG. {ECO:0000269|PubMed:29217193}.
Developmental stage：
Protein families：