RN114_RAT Q6J2U6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6J2U6
Recommended name：E3 ubiquitin-protein ligase RNF114
EC number：EC:2.3.2.27
Alternative names：RING finger protein 114 RING-type E3 ubiquitin transferase RNF114 Curated Zinc finger protein 313
Cleaved into：
GeneID：362277
Gene names (primary )：Rnf114
Gene names (synonym )：Zfp313, Znf313
Gene names (ORF )：
Length：229
Mass：25,664
Sequence：MAAAQPESRDGAAQSAKPASETDPLSRFTCPVCLEVFEKPVQVPCGHVFCSACLQECLKPKKPVCGVCRSALAPGVRAAELERQIESIETSCHGCRKDFVLSKIRAHVASCSKYQSYIMEGVKATTKDASLQQRNVPNRYTFPCPYCPEKNFDQEGLVEHCKLTHSTDTKSVVCPICASMPWGDPSYRSANFMEHIQRRHRFSYDTFVDYDVDEDDMINQVLQRSIIDQ
Tissue specificity：
Induction：
Developmental stage：
Protein families：