JUPI2_RAT   Q5BK20


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5BK20

Recommended name:Jupiter microtubule associated homolog 2 By Similarity

EC number:

Alternative names:

Cleaved into:

GeneID:360492

Gene names  (primary ):Jpt2 By Similarity

Gene names  (synonym ):Hn1l Imported

Gene names  (ORF ):

Length:190

Mass:20,070

Sequence:MFRGADGQASKSGFRSMKPPGGESNDIFGSPEEGVPSSKPHRMASNIFGPTEEPKNIPKRTNPPGGKGSGIFDESTPVQTRQRLNPPGGKTSDIFGSPVTATAPLAHPNKPKDHVLLCEGEDCKSDLKAATNSTPRGEQGEKGSSTEAEPAKIPEPIPTVDSHEPRLGPRPRSHNKVLNPPGGKSSISFY

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp