UCP1_RAT P04633
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P04633
Recommended name：Mitochondrial brown fat uncoupling protein 1 Curated
EC number：
Alternative names：Solute carrier family 25 member 7 By Similarity Thermogenin By Similarity
Cleaved into：
GeneID：24860
Gene names (primary )：Ucp1
Gene names (synonym )：Slc25a7 By Similarity, Ucp 1 Publication
Gene names (ORF )：
Length：307
Mass：33,212
Sequence：MVSSTTSEVQPTMGVKIFSAGVSACLADIITFPLDTAKVRLQIQGEGQASSTIRYKGVLGTITTLAKTEGLPKLYSGLPAGIQRQISFASLRIGLYDTVQEYFSSGRETPASLGSKISAGLMTGGVAVFIGQPTEVVKVRMQAQSHLHGIKPRYTGTYNAYRVIATTESLSTLWKGTTPNLMRNVIINCTELVTYDLMKGALVNHHILADDVPCHLLSALVAGFCTTLLASPVDVVKTRFINSLPGQYPSVPSCAMTMYTKEGPAAFFKGFAPSFLRLGSWNVIMFVCFEQLKKELMKSRQTVDCTT
Tissue specificity：Brown adipose tissue. 1
Induction：
Developmental stage：
Protein families：