VTCN1_MOUSE Q7TSP5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7TSP5
Recommended name:V-set domain containing T-cell activation inhibitor 1
EC number:
Alternative names:(B7 homolog 4) (B7-H4) (Immune costimulatory protein B7-H4) (Protein B7S1) (T cell costimulatory molecule B7x)
Cleaved into:
GeneID:242122
Gene names (primary ):Vtcn1
Gene names (synonym ):B7h4
Gene names (ORF ):
Length:283
Mass:30875
Sequence:MASLGQIIFWSIINIIIILAGAIALIIGFGISGKHFITVTTFTSAGNIGEDGTLSCTFEPDIKLNGIVIQWLKEGIKGLVHEFKEGKDDLSQQHEMFRGRTAVFADQVVVGNASLRLKNVQLTDAGTYTCYIRTSKGKGNANLEYKTGAFSMPEINVDYNASSESLRCEAPRWFPQPTVAWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTDSEVKRRSQLQLLNSGPSPCVFSSAFVAGWALLSLSCCLMLR
Tissue specificity:Expressed on the surface of professional antigen-presenting cells (at protein level). Widely expressed, including in kidney, liver, lung, pancreas, placenta, prostate, spleen, testis and thymus. {ECO:0000269|PubMed:12818165, ECO:0000269|PubMed:12818166, ECO:0000269|PubMed:12920180}.
Induction:Down-regulated upon activation of B-cells. {ECO:0000269|PubMed:12818166}.
Developmental stage:
Protein families:Immunoglobulin superfamily, BTN/MOG family