B4GT6_RAT O88419
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O88419
Recommended name：Beta-1,4-galactosyltransferase 6 Curated
EC number：EC:2.4.1.-
Alternative names：Beta-1,4-GalTase 6; Beta4Gal-T6; b4Gal-T6
Cleaved into：
GeneID：65196
Gene names (primary )：B4galt6
Gene names (synonym )：
Gene names (ORF )：
Length：382
Mass：44,778
Sequence：MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYSPHLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSEIEPGGHWRPQDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYSGYNVTRPEGDLGKYTSIPHHHRGEVQFLGRYKLLRYSKERQFIDGLNNLLYTPKILVDRLYTNISVNLMPELAPVEDY
Tissue specificity：Highest expression in brain with lower levels found in lungs, heart, skeletal muscle and kidney. Lowest expression in testis, liver and spleen. 1
Induction：
Developmental stage：
Protein families：