IGFL_MOUSE Q6B9Z0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6B9Z0
Recommended name:Insulin growth factor-like family member
EC number:
Alternative names:
Cleaved into:
GeneID:232925
Gene names (primary ):Igfl
Gene names (synonym ):Gm580 Igfl3 mIgfl
Gene names (ORF ):
Length:140
Mass:15667
Sequence:MKIRNACAVLIEVLLFILEGVTGARKISTFSGPGSWPCNPKCDGRTYNPSEECCVHDTILPFKRINLCGPSCTYRPCFELCCPESYSPKKKFIVKLKVHGERSHCSSSPISRNCKSNKIFHGEDIEDNQLSLRKKSGDQP
Tissue specificity:Highly expressed in skin. Also detected in colon, thymus, mammary gland, lymph node and lung. {ECO:0000269|PubMed:21454693}.
Induction:Up-regulated by Imiquimod. Up-regulated in skin upon tissue inflammation and injury. {ECO:0000269|PubMed:21454693}.
Developmental stage:
Protein families:IGFL family