MCSP_MOUSE P15265
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P15265
Recommended name：Sperm mitochondrial-associated cysteine-rich protein
EC number：
Alternative names：
Cleaved into：
GeneID：17235
Gene names (primary )：Smcp
Gene names (synonym )：Mcs Mcsp
Gene names (ORF )：
Length：143
Mass：14945
Sequence：MSDPSKTNQCPPPCCPPKPCCPPKPCCPQKPPCCPKSPCCPPKSPCCPPKPCPCPPPCPCPCPATCPCPLKPPCCPQKCSCCPKKCTCCPQPPPCCAQPTCCSSENKTESDSDTSGQTLEKGSQSPQSPPGAQGNWNQKKSNK
Tissue specificity：Testis. Is selectively expressed in the spermatids of seminiferous tubules. {ECO:0000269|PubMed:2303168, ECO:0000269|PubMed:8916043, ECO:0000269|PubMed:9409512}.
Induction：
Developmental stage：First detected in step 11 spermatids. Levels increase in subsequent steps to reach a maximum in late step 15 and early step 16. Levels decrease in late step 16. {ECO:0000269|PubMed:2303168, ECO:0000269|PubMed:8916043, ECO:0000269|PubMed:9409512}.
Protein families：